SKU: 23993764653

Human Jagged1, His tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Jagged1, His tagProduct Specification Species Human Synonyms hJ1, CD339, JAG1, JAGL1 Accession P78504 Amino Acid Sequence Protein sequence (P78504, Ser32 Ile335, with C 10*His)

Product Specification


Species Human
Synonyms hJ1, CD339, JAG1, JAGL1
Accession P78504
Amino Acid Sequence

Protein sequence (P78504, Ser32-Ile335, with C-10*His) SGQFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFEYQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 35.4 kDa Observed MW: 44 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Jagged1 (JAG1) is one of five cell surface proteins (ligands) that interact with four receptors in the mammalian Notch signaling pathway. The Notch Signaling Pathway is a highly conserved pathway that functions to establish and regulate cell fate decisions in many organ systems. Once the JAG1-NOTCH (receptor-ligand) interactions take place, a cascade of proteolytic cleavages is triggered resulting in activation of the transcription for downstream target genes. JAG1 gene is expressed in multiple organ systems in the body and causes the autosomal dominant disorder Alagille syndrome (ALGS) resulting from loss of function mutations within the gene. ALGS is an autosomal dominant multi-system disorder affecting several body systems including the liver, heart, skeleton, eye, facial structure, kidneys and vascular system. JAG1 expression changes have been implicated in many types of cancer. Up regulation of JAG1 has been correlated with both poor overall breast cancer survival rates and an enhancement of tumor proliferation in adrenocortical carcinoma patients.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23993764653

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tinman
Lexington, US
★★★★★ 5
Great stand for the price!
Size: Quad, Style: Glass Free Stand, Size: Quad, Style: Glass Free Stand
It is a great stand. I was able to put everything together myself. Just wanted to point out a couple of things here. I have 2, 27" flat montors and 2, 37" curved monitors. Now the description says it will go up to 27", but I was able to get the 37" ones on this stand also. You can put them side by side - they will fit, but make sure you don't go over the weight limit, so for mine, to be sure I didn't exceed the weight limit, I have the bottom of them sitting on the and foot of the frame itself. You will not be able to angle them inwards toward yourself if you have 37" curved monitors. This is what I was hoping to do I just needed an extra inch on each side to move them out, for now I will just leave them side by side. For assembly, because I was doing this by myself, I found it easiest to leave all the moveable parts loose and lay the monitors out on the floor face down in the position I wanted them in (NO CABLES). Then I took the mostly assembled frame and adjusted it to my monitors. I put the plates on the monitors and then slid the appropriate piece of the frame onto each plate, still leaving most parts slightly loose (giving myself just enough play to move things around when I stood it up). I then stood the frame up and firmed down all the fittings once I got everything where I wanted it. I then lifted the entire stand with monitors up onto my desk and then began plugging in all the cables and cords. I really like the stand and it is a great value for the price. It is very sturdy with my setup. I just wish it had about an extra inch on at least the bottom two arms, but overall, definitely a great stand. (sorry for the bad photo but these are my work monitors and I could not show what was on the screens)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
H
Verified Purchase
Hope Lyon
Phoenix, US
★★★★★ 5
Perfect! Level monitors, small footprint!
Size: Dual, Style: Glass Free Stand, Size: Dual, Style: Glass Free Stand
Perfect! This was the 3rd monitor stand I purchased this month. The others either were too bulky of a base and/or I could never get the monitors level! This is perfect! Was easy to assemble and it’s easy to move them & adjust tilt & spacing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
S
Verified Purchase
Sam tt
Carnegie, US
★★★★★ 4
Sturdy with good finish
Size: Dual, Style: Glass Free Stand
Easy to set up. Good finish. Sturdy. Using 2 x 27" monitors . A bit difficult to align them seamlessly. Suggest getting monitor alignment aids together with this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
D
Verified Purchase
Dan
San Leandro, US
★★★★★ 5
The best Quad Monitor Mount under $100
Size: Quad, Style: Glass Free Stand
Great monitor stand. I got the Quad. It's base is nice and you can put stuff on it unlike the other popular quad mount that is V shaped. You can get the monitors 98% aligned, then use gaffers tape for the last 1% (99% perfect, slight gaps that I couldn't fill). Strong, sturdy, tempered glass base, metal pole. And cheap price. This is the one to get for a quad setup. I stripped the bolt on the VESA monitor mount bracket and the seller took care of me. No worries.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
M
Verified Purchase
Marcus Gladney
Draper, US
★★★★★ 5
Excellent stand
Size: Dual, Style: Glass Free Stand
I love the functionality of this stand! It is very durable and stable. It does not require any form of anchoring to hold monitors. I have two 27 inch monitors attached to my stand with no problems. The stand can be moved in various direction with little effort. Excellent stand if you are looking to enhance your office space.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 27, 2024

recommand products