SKU: 52443107115

Mouse CD28, His tag

Sale price$144.00 Regular price$160.00
Save 10%

Pay in installments of $40.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 29 - Aug 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD28, His tagProduct Specification Species Mouse Synonyms T cell specific surface glycoprotein CD28 Accession P31041 Amino Acid Sequence Protein sequence (P31041, Asn20 Leu150, with C 10*His) NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 16. 9 kDa Observed MW: 35 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag

Product Specification


Species Mouse
Synonyms T-cell-specific surface glycoprotein CD28
Accession P31041
Amino Acid Sequence

Protein sequence (P31041, Asn20-Leu150, with C-10*His) NKILVKQSPLLVVDSNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLHVNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.9 kDa Observed MW: 35 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD28 (Cluster of Differentiation 28) is one of the proteins expressed on T cells that provide co-stimulatory signals required for T cell activation and survival. T cell stimulation through CD28 in addition to the T-cell receptor (TCR) can provide a potent signal for the production of various interleukins (IL-6 in particular). CD28 is the receptor for CD80 (B7.1) and CD86 (B7.2) proteins. CD28 is the only B7 receptor constitutively expressed on naive T cells. Association of the TCR of a naive T cell with MHC:antigen complex without CD28:B7 interaction results in a T cell that is anergic. CD28 was identified on bone marrow stromal cells, plasma cells, neutrophils and eosinophils. In addition, the level of positive CD28 decreases with age.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 52443107115

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
MISS JENNIFER TAYLOR
Los Angeles, US
★★★★★ 5
Nice toy
Style: Variety Pack - Large (3-pack)
Good idea, no stuffing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
J
Verified Purchase
J. Rothenberger
San Leandro, US
★★★★★ 3
The Ad got me, the reality didn't
Style: Variety Pack - Large (3-pack)
Directly from the ad- "Exclusive Noisemakers - Each large toy includes 3 high-quality round squeakers to deliver more sound to keep your best friend entertained.". Now my neighbor bought this squirrel with three high-quality squeakers nearly a year ago. It's ragged and tattered I just recently sewed it up for him where he chewed the one leg odd, but those three noise makers are still squeaking. Whe I got my pup, I immediately went to buy one and they were no longer selling them, so I've been on a search for one or an equivalent. These are not. There's no stuffing to get all over the place when your pup breaks into it, a plus. However the squeakers weren't particularly loud and were silenced in a few hours. Two were dead and the remaining one was very well on its way. The toy itself was pretty much intact but that had more to do with the lack of attention from the dog than how rugged the toy is. He'll pick it up once in a while but it certainly didn't meet my expectations. The good thing is that there are three of them so I can give him some brief excitement in the future. Wouldn't buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2023
E
Verified Purchase
Eileen
Omaha, US
★★★★★ 5
Strong Chewer Friendly Toy
Style: Variety Pack - Large (3-pack)
My dog is a rough chewer and these last a really long time (clearly since this beaver's face is long gone! The no stuffing is a win too for cleaning up afterwards.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
M
Verified Purchase
mauisuzi
Lexington, US
★★★★★ 5
More Durable Than Most
My puppy likes this. He ripped up the stuffing pretty quickly but the rope innards are strong. Both a tug toy and chew. I would prefer it unstuffed so 4 ⭐️ instead of 5.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2025
J
Verified Purchase
Joe
Alexandria, US
★★★★★ 5
My dogs favorite toy
Color: Ropiez Dragon
The dragon is pretty durable but I will say my dog chews off the horn the first chance she gets. There is no stuffing except for the horn. Holds up well in a tug of war and play. For an average to moderate aggressive dog it hold up for awhile. It’s not indestructible it will tear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2024

recommand products