SKU: 9355137261

IL-7 Protein, Human

Sale price$106.20 Regular price$118.00
Save 10%

Pay in installments of $29.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 28 - Aug 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-7 Protein, HumanProduct Specification Species Human Synonyms Interleukin 7 Accession P13232 Amino Acid Sequence Asp26 His177 with C terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH Expression System HEK293 Molecular Weight 18 30 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU mg Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Interleukin-7
Accession P13232
Amino Acid Sequence

Asp26-His177 with C-terminal 6*His Tag

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Expression System HEK293
Molecular Weight 18-30 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 10 mM PBS, pH 7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6.
2. J Biol Chem. 1997 Dec 26;272(52):32995-3000.
3. J Immunol. 1995 Jan 1;154(1):58-67.

Background

Interleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.

IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.

IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 9355137261

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Paige R.
Belleville, US
★★★★★ 5
Best Diaper Brand!
Size: Size 1, Unit Count: 96
Got these as a gift for my friend who just had a baby and she was thrilled! Never underestimate the simple gift of diapers to a momma with a newborn! Mother said she prefers these diapers because of their quality and softness. This is about the best price for high quality diapers you can find!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
L
Verified Purchase
ladyrider68
Massapequa, US
★★★★★ 5
Great Product-Love These
Size: Newborn, Unit Count: 31
We have tried other name brand diapers over the years and people rave about other brands, but our experience with other brands is not good. Even the hospital doesn't use this brand and baby's onesie kept getting wet. They were folding their Pampers down at top for umbilical cord where Huggies have cut out for umbilical cord. Our personal experience is other name brand diapers seem to leak with our babies, and these stay snug and keep clothes and baby dry. When it says 100% leak proof and all-around blowout blocker it's factual for us and our babies. They are easy to use and durable. We have babies with sensitive skin and there is no irritation with these diapers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
M
Verified Purchase
margaret
Birmingham, US
★★★★★ 5
Feat of diaper engineering
Size: Preemie, Unit Count: 30
I liked these well enough until my preemie had the biggest poo I’ve ever seen. That diaper probably weighed almost as much as he does and his white footie pajamas were untouched. Miracle. Worth every penny. Absolute legend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
A
Verified Purchase
Arianna
Omaha, US
★★★★★ 5
Perfect thank you
Size: Newborn, Unit Count: 144
These baby diapers have been an excellent choice. They are very soft against the skin, which helps prevent irritation or chafing—even for babies with sensitive skin. Their absorbency is excellent, keeping the baby dry for several hours, both day and night. Furthermore, the fit is comfortable and secure, allowing the baby to move freely without any leaks. Without a doubt, they are practical, reliable, and provide peace of mind for parents. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
C
Verified Purchase
Ciara
Charlottesville, US
★★★★★ 4
Outstanding, top of the line diaper!
Size: Preemie, Unit Count: 30
We normally use Huggies Little Movers with our 3.5 year old (nothing against them, they're also great diapers) but recently decided to give Swaddlers a try, and will not be going back. This is a top-of-the-line diaper and excels in all ways. We use a size 7 though could *probably* get away with a size 6, and use about 4-5 diapers a day on average (not including his overnight diaper) depending on how much he's had to drink and how often he poops -usually once a day, but could be as many as 3 times, especially if he doesn't go one day. The first thing you notice about these diapers is how soft they are. I mean, they just feel like they would be comfortable on a child, and since they're in them practically 24/7, that's important. The diaper is mostly white, and the overall designs are more muted than a lot of other diapers, with "Shilo and Friends" -an elephant and duck - on the front and back. I personally wouldn't mind something bolder, I don't think my child cares or even notices. There is a wetness indicator that goes down the length of the diaper, front and back. Nice to have I suppose for a caregiver who maybe doesn't change a lot of diapers, but at this age and stage, it's easy to know and tell. Like all Pampers diapers, they are scented. I happen to love the gentle powder-like scent, but it's a turn-off to some who describe it as too strong, and of course, if your child is sensitive to that, you may want to avoid Pampers diapers. Inside, the top sheet liner keeps his skin dry, even when he wets heavily -which is usually - and does a good job of keeping poop from sticking to his bottom. The "blowout barrier" in the back also helps contain any messes. In terms of absorbency, I'm pretty amazed at how much they can hold. Being a little older, he tends to stay drier for longer periods and then pee a larger amount at one time, but the diaper almost always holds it in, and leaks are rare. The one thing I wish that Pampers did do was have wider tapes, like Huggies, at least on the larger sizes, where kids are more active. It hasn't been a problem, so I don't really have a reason for saying that, other than that it seems like it would help with fit, but it certainly won't keep me from buying or using them in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026

recommand products